Description

  • Product name

    Recombinant Human Corin protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      CKERDLWECPSNKQCLKHTVICDGFPDCPDYMDEKNCSFCQDDELECANH ACVSRDLWCDGEADCSDSSDEWDCVTLSINVNSSSFLMVHRAATEHHVCA
    • Amino acids

      616 to 715
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153116 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • activated protease fragment
    • ATC 2
    • ATC2
    • Atrial natriuretic peptide-converting enzyme
    • Atrial natriuteric peptide converting enzyme
    • Corin
    • Corin serine peptidase
    • CORIN_HUMAN
    • CRN
    • Heart specific serine proteinase
    • Heart specific serine proteinase ATC2
    • Heart-specific serine proteinase ATC2
    • MGC119742
    • Pro ANP convertase
    • Pro ANP converting enzyme
    • Pro-ANP-converting enzyme
    • TMPRSS 10
    • TMPRSS10
    • Transmembrane protease serine 10
    see all
  • Function

    Serine-type endopeptidase involved in atrial natriuretic peptide hormone processing. Converts through proteolytic cleavage the non-functional propeptide NPPA/ANP into the active hormone which promotes natriuresis, diuresis, and vasodilatation. May also process pro-NPPB the B-type natriuretic peptide.
  • Tissue specificity

    Highly expressed in heart. Expressed in heart myocytes.
  • Sequence similarities

    Belongs to the peptidase S1 family.
    Contains 2 FZ (frizzled) domains.
    Contains 7 LDL-receptor class A domains.
    Contains 1 peptidase S1 domain.
    Contains 1 SRCR domain.
  • Post-translational
    modifications

    N-glycosylated; required for processing and activation.
    Activated through proteolytic processing by a trypsin-like protease; cleaved into a N-terminal propeptide and an activated corin protease fragment.
    A disulfide bond links the N-terminal propeptide and the activated corin protease fragment.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • ab153116 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153116 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153116.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up