Recombinant Human Corneodesmosin/S protein (ab114567)
Key features and details
- Expression system: Wheat germ
- Suitable for: SDS-PAGE, WB, ELISA
Description
-
Product name
Recombinant Human Corneodesmosin/S protein -
Expression system
Wheat germ -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
KIILQPCGSKSSSSGHPCMSVSSLTLTGGPDGSPHPDPSAGAKPCGSSSA GKIPCRSIRDILAQVKPLGPQLADPEVFLPQGELLNSP* -
Predicted molecular weight
35 kDa including tags -
Amino acids
442 to 529
-
Specifications
Our Abpromise guarantee covers the use of ab114567 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Western blot
ELISA
-
Form
Liquid -
Additional notes
This product was previously labelled as Corneodesmosin.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.3% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- AI747712
- CDSN
- CDSN_HUMAN
see all -
Function
Important for the epidermal barrier integrity. -
Tissue specificity
Exclusively expressed in skin. -
Involvement in disease
Defects in CDSN are a cause of hypotrichosis simplex of the scalp (HTSS) [MIM:146520]; also known as hypotrichosis Spanish type. HTSS is an autosomal dominant form of isolated alopecia. Affected individuals have normal hair in early childhood but experience progressive loss of scalp hair beginning in the middle of the first decade and almost complete baldness by the third decade.
Defects in CDSN are the cause of peeling skin syndrome type B (BPSS) [MIM:270300]; also known as peeling skin syndrome or deciduous skin or keratolysis exfoliativa congenita. BPSS is a genodermatosis characterized by the continuous shedding of the outer layers of the epidermis, associated with pruritus and atopy. It is an ichthyosiform erythroderma characterized by lifelong patchy peeling of the entire skin with onset at birth or shortly thereafter. Several patients have been reported with high IgE levels. -
Cellular localization
Secreted. Found in corneodesmosomes, the intercellular structures that are involved in desquamation. - Information by UniProt
Images
-
SDS-PAGE - Recombinant Human Corneodesmosin/S protein (ab114567)12.5% SDS-PAGE Stained with Coomassie Blue
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab114567 has not yet been referenced specifically in any publications.
