Description

  • Product name

    Recombinant Human CORO1B protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSFRKVVRQSKFRHVFGQPVKNDQCYEDIRVSRVTWDSTFCAVNPKFLAV IVEASGGGAFLVLPLSKTGRIDKAYPTVCGHTGPVLDIDWCPHNDEVIAS GSEDCTVMVWQIPENGLTSPLTEPVVVLEGHTKRVGIIAWHPTARNVLLS AGCDNVVLIWNVGTAEELYRLDSLHPDLIYNVSWNHNGSLFCSACKDKSV RIIDPRRGTLVAEREKAHEGARPMRAIFLADGKVFTTGFSRMSERQLALW DPENLEEPMALQELDSSNGALLPFYDPDTSVVYVCGKGDSSIRYFEITEE PPYIHFLNTFTSKEPQRGMGSMPKRGLEVSKCEIARFYKLHERKCEPIVM TVPRKSDLFQDDLYPDTAGPEAALEAEEWVSGRDADPILISLREAYVPSK QRDLKISRRNVLSDSRPAMAPGSSHLGAPASTTTAADATPSGSLARAGEA GKLEEVMQELRALRALVKEQGDRICRLEEQLGRMENGDA
    • Amino acids

      1 to 489
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163514 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • COR1B_HUMAN
    • CORO 1B
    • CORO1B
    • Coronin 1B
    • Coronin 2
    • Coronin actin binding protein 1B
    • Coronin-1B
    • Coronin-2
    • Coronin1B
    • Coronin2
    • DKFZP762I166
    • OTTHUMP00000236823
    see all
  • Function

    Regulates leading edge dynamics and cell motility in fibroblasts. May be involved in cytokinesis and signal transduction.
  • Sequence similarities

    Belongs to the WD repeat coronin family.
    Contains 5 WD repeats.
  • Post-translational
    modifications

    Phosphorylation by PKC on Ser-2 regulates the interaction with the Arp2/3 complex and cell motility in fibroblasts. Phosphorylation does not seem to affect subcellular location.
  • Cellular localization

    Cytoplasm > cytoskeleton. Localized to the leading edge in fibroblasts, as well as weakly along actin stress fibers.
  • Information by UniProt

Images

  • ab163514 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163514 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163514.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up