Description

  • Product name

    Recombinant Human Coronin 1a/TACO protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QEDLYPPTAGPDPALTAEEWLGGRDAGPLLISLKDGYVPPKSRELRVNRG LDTGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQ AK
    • Amino acids

      360 to 461
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161325 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as Coronin 1a

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Actin binding protein
    • CLABP
    • Clipin A
    • Clipin-A
    • CLIPINA
    • COR1A_HUMAN
    • CORO1A
    • Coronin 1
    • Coronin actin binding protein 1A
    • Coronin like protein A
    • Coronin like protein p57
    • Coronin-1A
    • Coronin-like protein A
    • Coronin-like protein p57
    • FLJ41407
    • HCORO1
    • MGC117380
    • OTTHUMP00000163017
    • p57
    • TACO
    • Tryptophan aspartate containing coat protein
    • Tryptophan aspartate-containing coat protein
    see all
  • Function

    May be a crucial component of the cytoskeleton of highly motile cells, functioning both in the invagination of large pieces of plasma membrane, as well as in forming protrusions of the plasma membrane involved in cell locomotion. In mycobacteria-infected cells, its retention on the phagosomal membrane prevents fusion between phagosomes and lysosomes.
  • Tissue specificity

    Expressed in brain, thymus, spleen, bone marrow and lymph node. Low in lung and gut.
  • Sequence similarities

    Belongs to the WD repeat coronin family.
    Contains 7 WD repeats.
  • Cellular localization

    Cytoplasm > cytoskeleton. Cytoplasm > cell cortex. Cytoplasmic vesicle > phagosome membrane. In non-infected macrophages, associated with the cortical microtubule network. In mycobacteria-infected macrophages, becomes progressively relocalized and retained around the mycobacterial phagosomes. Retention on the phagosomal membrane is strictly dependent on mycobacterial viability and not due to impaired acidification.
  • Information by UniProt

Images

  • ab161325 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161325 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161325.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up