Description

  • Product name

    Recombinant Human Cortactin protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MWKASAGHAVSIAQDDAGADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQ EHINIHKLRENVFQEHQTLKEKELETGPKASHGYGGKFGVEQDRMDKSAV GHEYQSKLSKHCSQVDSVRGFGGKFGVQMDRVDQSAVGFEYQGKTEKHAS QKDYSSGFGGKYGVQADRVDKSAVGFDYQGKTEKHESQRDYSKGFGGKYG IDKDKVDKSAVGFEYQGKTEKHESQKDYVKGFGGKFGVQTDRQDKCALGW DHQEKLQLHESQKDYSKGFGGKYGVQKDRMDKNASTFEDVTQVSSAYQKT VPVEAVTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEA RRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVYEDAASFKAELSYRGPV SGTEPEPVYSMEAADYREASSQQGLAYATEAVYESAEAPGHYPAEDSTYD EYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGR YGLFPANYVELRQ
    • Predicted molecular weight

      84 kDa including tags
    • Amino acids

      1 to 513
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab131824 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Amplaxin
    • CTTN
    • EMS 1
    • EMS1
    • FLJ34459
    • Mammary tumor and squamous cell carcinoma associated
    • Oncogene EMS1
    • p80/85 src substrate
    • Src substrate cortactin
    • SRC8_HUMAN
    see all
  • Function

    Contributes to the organization of the actin cytoskeleton and cell structure. Plays a role in the regulation of cell migration. Plays a role in the invasiveness of cancer cells, and the formation of metastases.
  • Sequence similarities

    Contains 7 cortactin repeats.
    Contains 1 SH3 domain.
  • Domain

    The SH3 motif may mediate binding to the cytoskeleton.
  • Post-translational
    modifications

    Tyrosine phosphorylation in transformed cells may contribute to cellular growth regulation and transformation.
  • Cellular localization

    Cytoplasm > cytoskeleton. Cell projection > lamellipodium. Cell projection > ruffle. Associated with membrane ruffles and lamellipodia.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131824 stained with Coomassie Blue.

References

ab131824 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131824.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up