Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEIIGK
    • Amino acids
      154 to 196
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158199 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Corticoliberin
    • Corticotropin releasing factor
    • Corticotropin releasing hormone
    • CRF
    • Crh
    • CRH1
    see all
  • Relevance
    CRF precursor is a 41-amino acid peptide derived from a 196-amino acid preprohormone. CRF is a neuroendocrine hormone secreted by the paraventricular nucleus (PVN) of the hypothalamus and is a key player in the hypothalamic pituitary adrenal axis. It is also synthesized in peripheral tissues, such as T lymphocytes and is highly expressed in the placenta. Neuronal CRF is important in a variety of diverse roles including, memory, depression, stress, kidney function, parturition, metabolism and feeding (to mention a few).
  • Cellular localization
    Cytoplasmic and Secreted

Images

  • ab158199 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158199 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158199.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up