Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MDPNAAYVNMSNHHRGLASANVDFAFSLYKHLVALSPKKNIFISPVSISM ALAMLSLGTCGHTRAQLLQGLGFNLTERSETEIHQGFQHLHQLFAKSDTS LEMTMGNALFLDGSLELLESFSADIKHYYESEVLAMNFQDWATASRQINS YVKNKTQGKIVDLFSGLDSPAILVLVNYIFFKGTWTQPFDLASTREENFY VDETTVVKVPMMLQSSTISYLHDAELPCQLVQMNYVGNGTVFFILPDKGK MNTVIAALSRDTINRWSAGLTSSQVDLYIPKVTISGVYDLGDVLEEMGIA DLFTNQANFSRITQDAQLKSSKVVHKAVLQLNEEGVDTAGSTGVTLNLTS KPIILRFNQPFIIMIFDHFTWSSLFLARVMNPVLDHHHHHH
    • Molecular weight

      44 kDa including tags
    • Amino acids

      23 to 405
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153766 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. ab153766 was lyophilised from a 0.2 µM filtered solution.
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C.

    pH: 7.40
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. Dissolve the lyophilised protein in 1X PBS. It is not recommended to reconstitute to a concentration less than 100 µg/ml.
    Reconstituted protein solution can be stored at 4-7°C for 2-7 days. For long term storage aliquot and store at < -20°C.

General Info

  • Alternative names

    • CBG
    • CBG_HUMAN
    • corticosteroid binding globulin
    • Corticosteroid-binding globulin
    • serine (or cysteine) proteinase inhibitor clade A (alpha 1 antiproteinase antitrypsin) member 6
    • Serpin A6
    • serpin peptidase inhibitor clade A (alpha 1 antiproteinase antitrypsin) member 6
    • Serpina6
    • Transcortin
    see all
  • Function

    Major transport protein for glucocorticoids and progestins in the blood of almost all vertebrate species.
  • Tissue specificity

    Plasma; synthesized in liver. Has also been identified in a number of glycocorticoid responsive cells.
  • Involvement in disease

    Defects in SERPINA6 are a cause of corticosteroid-binding globulin deficiency (CBG deficiency) [MIM:611489]. CBG deficiency is an extremely rare hereditary disorder characterized by reduced corticosteroid-binding capacity with normal or low plasma corticosteroid-binding globulin concentration, and normal or low basal cortisol levels associated with hypo/hypertension and muscle fatigue.
  • Sequence similarities

    Belongs to the serpin family.
  • Post-translational
    modifications

    N-glycosylated; binds 5 oligosaccharide chains.
    Glycosylation in position Asn-260 is needed for steroid binding.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab153766 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153766.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up