Description

  • Product name

    Recombinant Human COSMC protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MLSESSSFLKGVMLGSIFCALITMLGHIRIGHGNRMHHHEHHHLQAPNKE DILKISEDERMELSKSFRVYCIILVKPKDVSLWAAVKETWTKHCDKAEFF SSENVKVFESINMDTNDMWLMMRKAYKYAFDKYRDQYNWFFLARPTTFAI IENLKYFLLKKDPSQPFYLGHTIKSGDLEYVGMEGGIVLSVESMKRLNSL LNIPEKCPEQGGMIWKISEDKQLAVCLKYAGVFAENAEDADGKDVFNTKS VGLSIKEAMTYHPNQVVEGCCSDMAVTFNGLTPNQMHVMMYGVYRLRAFG HIFNDALVFLPPNGSDND
    • Amino acids

      1 to 318
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162210 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as C1GALT1C1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • HSPC067
    • 3-galactosyltransferase 2
    • Beta 1,3 galactosyltransferase 2
    • Beta1,3 galactosyltransferase 2
    • C1Gal T2
    • C1Gal-T2
    • C1GALT1 specific chaperone 1
    • C1GALT1-specific chaperone 1
    • C1galt1c1
    • C1GalT2
    • C1GLC_HUMAN
    • C38H2 L1
    • C38H2 like protein 1
    • C38H2-L1
    • C38H2-like protein 1
    • C38H2L1
    • Core 1 beta1
    • Core 1 beta3 galactosyltransferase specific molecular chaperone
    • Core 1 beta3-Gal-T2
    • Core 1 beta3-galactosyltransferase-specific molecular chaperone
    • Core 1 UDP galactose:N acetylgalactosamine alpha R beta 1,3 galactosyltransferase 2
    • COSMC
    • MGC19947
    • MST143
    see all
  • Function

    Probable chaperone required for the generation of 1 O-glycan Gal-beta1-3GalNAc-alpha1-Ser/Thr (T antigen), which is a precursor for many extended O-glycans in glycoproteins. Probably acts as a specific molecular chaperone assisting the folding/stability of core 1 beta-3-galactosyltransferase (C1GALT1).
  • Tissue specificity

    Ubiquitously expressed. Abundantly expressed in salivary gland, stomach, small intestine, kidney, and testis and at intermediate levels in whole brain, cerebellum, spinal cord, thymus, spleen, trachea, lung, pancreas, ovary, and uterus.
  • Involvement in disease

    Defects in C1GALT1C1 are the cause of Tn syndrome (TNSYN) [MIM:300622]. Tn syndrome is a rare autoimmune disease caused by somatic mutation in the C1GALT1C1 gene in which subpopulations of blood cells of all lineages carry an incompletely glycosylated membrane glycoprotein, i.e. the Tn antigen. Since leukocytes and platelets are affected as well as red cells, anemia, leukopenia and thrombocytopenia are features. Tn-polyagglutinability is sometimes associated with leukemia or is a preleukemic state.
  • Sequence similarities

    Belongs to the glycosyltransferase 31 family. Beta3-Gal-T subfamily.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • ab162210 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162210 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162210.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up