Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSRSLLLWFLLFLLLLPPLPVLLADPGAPTPVNPCCYYPCQHQGICVRFG LDRYQCDCTRTGYSGPNCTIPGLWTWLRNSLRPSPSFTHFLLTHGRWFWE FVNATFIREMLMRLVLTVRSNLIPSPPTYNSAHDYISWESFSNVSYYTRI LPSVPKDCPTPMGTKGKKQLPDAQLLARRFLLRRKFIPDPQGTNLMFAFF AQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQYQLRLFKDGK LKYQVLDGEMYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLY ATLWLREHNRVCDLLKAEHPTWGDEQLFQTTRLILIGETIKIVIEEYVQQ LSGYFLQLKFDPELLFGVQFQYRNRIAMEFNHLYHWHPLMPDSFKVGSQE YSYEQFLFNTSMLVDYGVEALVDAFSRQIAGRIGGGRNMDHHILHVAVDV IRESREMRLQPFNEYRKRFGMKPYTSFQELVGEKEMAAELEELYGDIDAL EFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPICSPEYWKPSTFG GEVGFNIVKTATLKKLVCLNTKTCPYVSFRVPDASQDDGPAVERPSTELD YKDDDDKHHHHHH
    • Molecular weight
      71 kDa including tags
    • Amino acids
      1 to 599
    • Tags
      His-DDDDK tag C-Terminus
    • Additional sequence information
      NM_000962.

Specifications

Our Abpromise guarantee covers the use of ab198643 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Mixed various concentrations of enzyme in Assay buffer (100 mM Tris-HCl pH 8, 3 µM EDTA) with 5 µM Hematin for 10 min
    then added 100 µM Ampliflu Red and 200 μM arachidonic acid. Fluorescence (ex. 535 em. 590) was measured after 5
    minutes at room temperature. Reaction volume was 100 μl. Application: Useful for the study of enzyme kinetics, screening inhibitors and selectivity profiling.

  • Applications

    SDS-PAGE

    Functional Studies

  • Purity
    >= 90 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.04% Tween, 20% Glycerol, 0.08% Triton-X-100, 0.0067% Diethyldithiocarbamate

    Contains 80 µg/ml DDDDK peptide.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • COX 1
    • COX 3
    • COX-1
    • COX1
    • Cox3
    • Cyclooxygenase 1
    • Cyclooxygenase 3, included
    • Cyclooxygenase-1
    • EC 1.14.99.1
    • Partial COX1 proteins, included
    • PCOX1
    • PGG/HS
    • PGH synthase 1
    • PGH1_HUMAN
    • PGHS-1
    • PGHS1
    • PHS 1
    • PHS1
    • Prostaglandin G/H synthase 1
    • Prostaglandin H2 synthase 1
    • Prostaglandin-endoperoxide synthase 1
    • Prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase)
    • PTGHS
    • PTGS1
    see all
  • Function
    May play an important role in regulating or promoting cell proliferation in some normal and neoplastically transformed cells.
  • Pathway
    Lipid metabolism; prostaglandin biosynthesis.
  • Sequence similarities
    Belongs to the prostaglandin G/H synthase family.
    Contains 1 EGF-like domain.
  • Cellular localization
    Microsome membrane. Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • 4-20% SDS-PAGE analysis of 1.2 µg ab198643 with Coomassie staining.

  • Mixed various concentrations of enzyme in Assay buffer (100 mM Tris-HCl pH 8, 3 µM EDTA) with 5 µM Hematin for 10 min then added 100 µM Ampliflu Red and 200 μM arachidonic acid. Fluorescence (ex. 535 em. 590) was measured after 5 minutes at room temperature. Reaction volume was 100 μl.

References

ab198643 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198643.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up