Recombinant human COX2 / Cyclooxygenase 2 protein (ab198646)

Description

  • Product name

    Recombinant human COX2 / Cyclooxygenase 2 protein
    See all COX2 / Cyclooxygenase 2 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MLARALLLCAVLALSHTANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFY GENCSTPEFLTRIKLFLKPTPNTVHYILTHFKGFWNVVNNIPFLRNAIMS YVLTSRSHLIDSPPTYNADYGYKSWEAFSNLSYYTRALPPVPDDCPTPLG VKGKKQLPDSNEIVEKLLLRRKFIPDPQGSNMMFAFFAQHFTHQFFKTDH KRGPAFTNGLGHGVDLNHIYGETLARQRKLRLFKDGKMKYQIIDGEMYPP TVKDTQAEMIYPPQVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD VLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPE LLFNKQFQYQNRIAAEFNTLYHWHPLLPDTFQIHDQKYNYQQFIYNNSIL LEHGITQFVESFTRQIAGRVAGGRNVPPAVQKVSQASIDQSRQMKYQSFN EYRKRFMLKPYESFEELTGEKEMSAELEALYGDIDAVELYPALLVEKPRP DAIFGETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEVGFQIINTASI QSLICNNVKGCPFTSFSVPDPELIKTVTINASSSRSGLDDINPTVLLKER STELDYKDDDDKHHHHHH
    • Predicted molecular weight

      71 kDa including tags
    • Amino acids

      1 to 604
    • Tags

      His-DDDDK tag C-Terminus
    • Additional sequence information

      GenBank Accession No. NM_000963

Specifications

Our Abpromise guarantee covers the use of ab198646 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.04% Tween, 20% Glycerol, 0.08% Triton-X-100, 0.01% Diethyldithiocarbamate

    Contains 80 µg/ml DDDDK peptide.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • COX 2
    • COX-2
    • COX2
    • Cyclooxygenase
    • Cyclooxygenase 2
    • Cyclooxygenase 2b
    • Cyclooxygenase-2
    • Cyclooxygenase2
    • EC 1.14.99.1
    • fj02a10
    • Glucocorticoid-regulated inflammatory cyclooxygenase
    • Glucocorticoid-regulated inflammatory Prostaglandin G/H synthase
    • GRIPGHS
    • hCox 2
    • Macrophage activation-associated marker protein P71/73
    • OTTHUMP00000033524
    • PES-2
    • PGG/HS
    • PGH synthase 2
    • PGH2_HUMAN
    • PGHS 2
    • PGHS-2
    • PGHS2
    • PHS 2
    • PHS II
    • PHS2
    • Prostaglandin endoperoxide synthase 2
    • Prostaglandin endoperoxide synthase 2 (prostaglandin G/H synthase and cyclooxygenase)
    • Prostaglandin G/H synthase
    • Prostaglandin G/H synthase 2
    • Prostaglandin G/H synthase 2 precursor
    • Prostaglandin G/H synthase and cyclooxygenase
    • Prostaglandin H2 synthase 2
    • Prostaglandin-endoperoxide synthase 2
    • prostaglandin-endoperoxide synthase 2 (prostaglandin G/H synthase and cyclooxygenase)
    • PTGS2
    • ptgs2a
    • TIS10
    • TIS10 protein
    • unp1239
    • wu:fj02a10
    see all
  • Function

    Mediates the formation of prostaglandins from arachidonate. May have a role as a major mediator of inflammation and/or a role for prostanoid signaling in activity-dependent plasticity.
  • Pathway

    Lipid metabolism; prostaglandin biosynthesis.
  • Sequence similarities

    Belongs to the prostaglandin G/H synthase family.
    Contains 1 EGF-like domain.
  • Post-translational
    modifications

    S-nitrosylation by NOS2 (iNOS) activates enzme activity. S-nitrosylation may take place on different Cys residues in addition to Cys-561.
  • Cellular localization

    Microsome membrane. Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • 4-20% SDS Page analysis of ab198646 (2 μg)

  • Mixed various concentrations of enzyme in assay buffer (100 mM Tris-HCl pH 8, 3 uM EDTA) with 5 μM Hematin for 10 min then added 100 M Ampliflu Red and 200 μM arachidonic acid. Fluorescence (ex. 535 em. 590) was measured after 5 minutes at room temperature. Reaction volume was 100 μl.

References

ab198646 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198646.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up