Overview

  • Product name
    Recombinant Human COX7A2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLRNLLALRQIGQRTISTASRRHFKNKVPEKQKLFQEDDEIPLYLKGGVA DALLYR
    • Amino acids
      1 to 56
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158179 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • COX7A2
    • COX7AL
    • COX7AL1
    • COXVIIa L
    • COXVIIAL
    • CX7A2_HUMAN
    • Cytochrome c oxidase polypeptide 7A2 mitochondrial
    • Cytochrome c oxidase polypeptide VIIa liver/heart
    • Cytochrome c oxidase subunit 7A2
    • Cytochrome c oxidase subunit 7A2 mitochondrial
    • Cytochrome c oxidase subunit VIIa polypeptide 2
    • Cytochrome c oxidase subunit VIIa-L
    • Cytochrome c oxidase subunit VIIa-liver/heart
    • Cytochrome c oxidase subunit VIIaL
    • Hepatic cytochrome c oxidase chain VIIa
    • MGC118950
    • MGC118951
    • MGC118952
    • MGC126875
    • MGC126877
    • mitochondrial
    • VIIAL
    see all
  • Function
    This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.
  • Sequence similarities
    Belongs to the cytochrome c oxidase VIIa family.
  • Cellular localization
    Mitochondrion inner membrane.
  • Information by UniProt

Images

  • ab158179 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158179 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158179.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up