Description

  • Product name

    Recombinant Human COX8C protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MPLLRGRCPARRHYRRLALLGLQPAPRFAHSGPPRQRPLSAAEMAVGLVV FFTTFLTPAAYVLGNLKQFRRN
    • Amino acids

      1 to 72
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166293 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • COX VIII-3
    • COX8-3
    • Cox8c
    • COX8C_HUMAN
    • cytochrome c oxidase polypeptide 8
    • Cytochrome c oxidase polypeptide 8 isoform 3
    • cytochrome c oxidase polypeptide VIII
    • Cytochrome c oxidase polypeptide VIII isoform 3
    • Cytochrome c oxidase subunit 8-3
    • Cytochrome c oxidase subunit 8C
    • Cytochrome c oxidase subunit 8C, mitochondrial
    • cytochrome c oxidase subunit VIII
    • cytochrome c oxidase subunit VIIIC
    • mitochondrial
    see all
  • Function

    This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.
  • Tissue specificity

    It is not yet known where COX8C is expressed.
  • Sequence similarities

    Belongs to the cytochrome c oxidase VIII family.
  • Cellular localization

    Mitochondrion inner membrane.
  • Information by UniProt

Images

  • ab166293 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166293 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166293.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up