Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      LSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQ VIILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQ CKVKKAPGVANKKIHLVVLVKPSGARCYVDGSEEIGSDFKIKCEPKEGSL PLQYEWQKLSDSQKMPTSWLAEMTSSVISVKNASSEYSGTYSCTVRNRVG SDQCLLRLNVVPPSNKAGVDHHHHHH
    • Molecular weight

      25 kDa including tags
    • Amino acids

      20 to 217
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151334 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Purtiy is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form

    Lyophilised
  • Additional notes

     This product was previously labelled as Coxsackie Adenovirus Receptor

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.

    pH: 7.20
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Dissolve the lyophilized protein in 1X PBS. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names

    • 46 kD coxsackievirus and adenovirus receptor CAR protein
    • 46 kD coxsackievirus and adenovirus receptor protein
    • CAR
    • CAR4/6
    • Coxsackie virus and adenovirus receptor
    • Coxsackie virus B receptor
    • Coxsackievirus and adenovirus receptor
    • Coxsackievirus B adenovirus receptor
    • Coxsackievirus B-adenovirus receptor
    • CVB3 binding protein
    • CVB3-binding protein
    • Cxadr
    • CXADR Ig like cell adhesion molecule
    • CXAR_HUMAN
    • hCAR
    • HCVADR
    see all
  • Function

    Component of the epithelial apical junction complex that is essential for the tight junction integrity. Proposed to function as a homophilic cell adhesion molecule. Recruits MPDZ to intercellular contact sites. Probably involved in transepithelial migration of polymorphonuclear leukocytes (PMN) through adhesive interactions with AMICA1/JAML located in the plasma membrane of PMN.
  • Tissue specificity

    Expressed in pancreas, brain, heart, small intestine, testis, prostate and at a lower level in liver and lung. Isoform 5 is ubiquitously expressed. Isoform 3 is expressed in heart, lung and pancreas. In skeletal muscle, isoform 1 is found at the neuromuscular junction and isoform 2 is found in blood vessels. In cardiac muscle, isoform 1 and isoform 2 are found at intercalated disks. In heart expressed in subendothelial layers of the vessel wall but not in the luminal endothelial surface. Expression is elevated in hearts with dilated cardiomyopathy.
  • Sequence similarities

    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
  • Domain

    The Ig-like C2-type 1 domain probably mediates homodimerization and interaction with JAML.
    The PDZ-binding motif mediates interaction with MPDZ and BAIAP1.
  • Post-translational
    modifications

    N-glycosylated.
    Palmitoylated on Cys-259 and/or Cys-260; required for proper localization to the plasma membrane.
  • Cellular localization

    Secreted and Cell membrane. Cell junction > tight junction. Cell junction > adherens junction. Basolateral cell membrane. In epithelial cells localizes to the apical junction complex composced of tight and adherens junctions. In airway epithelial cells localized to basolateral membrane but not to apical surface.
  • Information by UniProt

References

ab151334 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151334.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up