Description

  • Product name

    Recombinant Human CPA3 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MRLILPVGLIATTLAIAPVRFDREKVFRVKPQDEKQADIIKDLAKTNELD FWYPGATHHVAANMMVDFRVSEKESQAIQSALDQNKMHYEILIHDLQEEI EKQFDVKEDIPGRHSYAKYNNWEKIVAWTEKMMDKYPEMVSRIKIGSTVE DNPLYVLKIGEKNERRKAIFMDCGIHAREWVSPAFCQWFVYQATKTYGRN KIMTKLLDRMNFYILPVFNVDGYIWSWTKNRMWRKNRSKNQNSKCIGTDL NRNFNASWNSIPNTNDPCADNYRGSAPESEKETKAVTNFIRSHLNEIKVY ITFHSYSQMLLFPYGYTSKLPPNHEDLAKVAKIGTDVLSTRYETRYIYGP IESTIYPISGSSLDWAYDLGIKHTFAFELRDKGKFGFLLPESRIKPTCRE TMLAVKFIAKYILKHTS
    • Amino acids

      1 to 417
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158188 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • carboxypeptidase A
    • Carboxypeptidase A3
    • carboxypeptidase A3 (mast cell)
    • carboxypeptidase A3 mast cell
    • CBPA3_HUMAN
    • Cpa3
    • Mast cell carboxypeptidase A
    • mast cell carboxypeptidase A3
    • MC CPA
    • MC-CPA
    • tissue carboxypeptidase A
    see all
  • Sequence similarities

    Belongs to the peptidase M14 family.
  • Cellular localization

    Cytoplasmic vesicle > secretory vesicle. Secretory granules.
  • Information by UniProt

Images

  • ab158188 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158188 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158188.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up