Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      NASFAGKGASDNPCSEVYHGPHANSEVEVKSVVDFIQKHGNFKGFIDLHS YSQLLMYPYGYSVKKAPDAEELDKVARLAAKALASVSGTEYQVGPTCTTV YP
    • Amino acids
      260 to 361
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162456 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Carboxypeptidase A3
    • Carboxypeptidase A4
    • CBPA4_HUMAN
    • CPA3
    • Cpa4
    see all
  • Function
    Metalloprotease that could be involved in the histone hyperacetylation pathway.
  • Tissue specificity
    Fetal expression in the adrenal gland, brain, heart, intestine, kidney, liver and lung. Except for fetal brain that shows no imprinting, expression was found preferentially from the maternal allele.
  • Sequence similarities
    Belongs to the peptidase M14 family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab162456 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162456 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162456.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up