Description

  • Product name

    Recombinant Human CPM protein
    See all CPM proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      LDFNYHRQEGMEAFLKTVAQNYSSVTHLHSIGKSVKGRNLWVLVVGRFPK EHRIGIPEFKYVANMHGDETVGRELLLHLIDYLVTSDGKDPEITNLINST RIHIMPSMNPDGFEAVKKPDCYYSIGRENYNQYDLNRNFPDAFEYNNVSR QPETVAVMKWLKTETFVLSANLHGGALVASYPFDNGVQATGALYSRSLTP DDDVFQYLAHTYASRNPNMKKGDECKNKMNFPNGVTNGYSWYPLQGGMQD YNYIWAQCFEITLELSCCKYPREEKLPSFWNNNKASLIEYIKQVHLGVKG QVFDQNGNPLPNVIVEVQDRKHICPYRTNKYGEYYLLLLPGSYIINVTVP GHDPHITKVIIPEKSQNFSALKKDILLPFQGQLDSIPVSNPSCPMIPLYR NLPDHVDHHHHHH
    • Predicted molecular weight

      47 kDa including tags
    • Amino acids

      18 to 422
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is for the mature full length protein from aa 18 to 422. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab191938 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 0.32% Tris HCl, 0.87% Sodium chloride

    Supplied as a 0.2 µM filtered solution.

General Info

  • Alternative names

    • Carboxypeptidase M
    • CBPM_HUMAN
    • CPM
    • Renal carboxypeptidase
    • Urinary carboxypeptidase B
    see all
  • Function

    Specifically removes C-terminal basic residues (Arg or Lys) from peptides and proteins. It is believed to play important roles in the control of peptide hormone and growth factor activity at the cell surface, and in the membrane-localized degradation of extracellular proteins.
  • Sequence similarities

    Belongs to the peptidase M14 family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

References

ab191938 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191938.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up