Overview

  • Product name

    Recombinant Human CPN1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MSDLLSVFLHLLLLFKLVAPVTFRHHRYDDLVRTLYKVQNECPGITRVYS IGRSVEGRHLYVLEFSDHPGIHEPLEPEVKYVGNMHGNEALGRELMLQLS EFLCEEFRNRNQRIVQLIQDTRIHILPSMNPDGYEVAAAQGPNKPGYLVG RNNANGVDLNRNFPDLNTYIYYNEKYGGPNHHLPLPDNWKSQVEPETRAV IRWMHSFNFVLSANLHGGAVVANYPYDKSFEHRVRGVRRTASTPTPDDKL FQKLAKVYSYAHGWMFQGWNCGDYFPDGITNGASWYSLSKGMQDFNYLHT NCFEITLELSCDKFPPEEELQREWLGNREALIQFLEQVHQGIKGMVLDEN YNNLANAVISVSGINHDVTSGDHGDYFRLLLPGIYTVSATAPGYDPETVT VTVGPAEPTLVNFHLKRSIPQVSPVRRAPSRRHGVRAKVQPQARKKEMEM RQLQRGPA
    • Amino acids

      1 to 458
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158192 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ACBP
    • Anaphylatoxin inactivator
    • Arginine carboxypeptidase
    • Carboxypeptidase N catalytic chain
    • Carboxypeptidase N polypeptide 1
    • Carboxypeptidase N polypeptide 1 50 kD
    • Carboxypeptidase N small subunit
    • Carboxypeptidase N subunit 1
    • CBPN_HUMAN
    • CPN
    • CPN1
    • Kininase 1
    • Kininase-1
    • Kininase1
    • Lysine carboxypeptidase
    • Plasma carboxypeptidase B
    • SCPN
    • Serum carboxypeptidase N
    see all
  • Function

    Protects the body from potent vasoactive and inflammatory peptides containing C-terminal Arg or Lys (such as kinins or anaphylatoxins) which are released into the circulation.
  • Tissue specificity

    Synthesized in the liver and secreted in plasma.
  • Involvement in disease

    Defects in CPN1 are the cause of carboxypeptidase N deficiency (CPND) [MIM:212070]. Patients affected present some combination of angioedema or chronic urticaria, as well as hay fever or astma, and have also slightly depressed serum carboxy peptidase N, suggestive of autosomal recessive inheritance of this disorder.
  • Sequence similarities

    Belongs to the peptidase M14 family.
  • Cellular localization

    Secreted > extracellular space.
  • Information by UniProt

Images

  • ab158192 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158192 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158192.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up