Description

  • Product name

    Recombinant Human CPNE5 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MKKKKYVNSGTVTLLSFAVESECTFLDYIKGGTQINFTVAIDFTASNGNP SQSTSLHYMSPYQLNAYALALTAVGEIIQHYDSDKMFPALGFGAKLPPDG RVSHEFPLNGNQENPSCCGIDGILEAYHRSLRTVQLYGPTNFAPVVTHVA RNAAAVQDGSQYSVLLIITDGVISDMAQTKEAIVNAAKLPMSIIIVGVGQ AEFDAMVELDGDDVRISSRGKLAERDIVQFVPFRDYVDRTGNHVLSMARL ARDVLAEIPDQLVSYMKAQGIRPRPPPAAPTHSPSQSPARTPPASPLHTH I
    • Amino acids

      1 to 301
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163627 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • A830083G22Rik
    • Copine 5
    • Copine V
    • Copine-5
    • Copine5
    • CopineV
    • COPN 5
    • COPN5
    • CPN 5
    • CPN5
    • CPNE 5
    • CPNE5
    • CPNE5_HUMAN
    • DKFZp666C234
    • KIAA1599
    • MGC47475
    • OTTHUMP00000039675
    see all
  • Function

    May function in membrane trafficking. Exhibits calcium-dependent phospholipid binding properties.
  • Sequence similarities

    Belongs to the copine family.
    Contains 2 C2 domains.
    Contains 1 VWFA domain.
  • Information by UniProt

Images

  • ab163627 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163627 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163627.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up