Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMSAAEAGGVFHRARGRTLAAFPAEKES EWKGPFYFILGADPQFGLIKAWSTGDCDNGGDEWEQEIRLTEQAVQAINK LNPKPKFFVLCGDLIHAMPGKPWRTEQTEDLKRVLRAVDRAIPLVLVSGN HDIGNTPTAETVEEFCRTWGDDYFSFWVGGVLFLVLNSQFYENPSKCPSL KQAQDQWLDEQLSIARQRHCQHAIVFQHIPLFLESIDEDDDYYFNLSKST RKKLADKFIHAGVKVVFSGHYHRNAGGTYQNLDMVVSSAIGCQLGRDPHG LRVVVVTAEKIVHRYYSLDELSEKGIEDDLMDLIKKK
    • Molecular weight
      38 kDa including tags
    • Amino acids
      1 to 314
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab156722 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 85 % SDS-PAGE.
    ab156722 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names
    • Calcineurin like phosphoesterase domain containing 1
    • Calcineurin-like phosphoesterase domain-containing protein 1
    • Complete S transactivated protein 1
    • Complete S-transactivated protein 1
    • CPPED_HUMAN
    • cpped1
    • CSTP1
    • Hypothetical protein LOC55313
    • Uncharacterized metallophosphoesterase CSTP1
    see all
  • Sequence similarities
    Belongs to the metallophosphoesterase superfamily. CPPED1 family.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab156722 (3 µg).

References

ab156722 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab156722.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up