Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACG KGGMCPFRHISGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYS KFGECSNKECPFLHIDPESKIKDCPWYDRGFCKHGPLCRHRHTRRVICVN YLVGFCPEGPSCKFMHPRFELPMGTTEQPPLPQQTQPPAKQRTPQVIGVM QSQNSSAGNRGPRPLEQVTCYKCGEKGHYANRCTKGHLAFLSGQ
    • Amino acids
      1 to 244
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161192 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • cleavage and polyadenylation specific factor 4, 30kDa
    • Cleavage and polyadenylation specificity factor 30 kDa subunit
    • Cleavage and polyadenylation specificity factor subunit 4
    • cleavage polyadenylation specificity factor, 30kD
    • CPSF 30 kDa subunit
    • CPSF30
    • Cpsf4
    • CPSF4_HUMAN
    • NAR
    • Neb-1
    • NEB1
    • No arches homolog
    • no arches like zinc finger protein
    • NS1 effector domain binding protein 1
    • NS1 effector domain-binding protein 1
    • OTTHUMP00000206235
    • OTTHUMP00000206237
    • OTTHUMP00000206239
    see all
  • Function
    Component of the cleavage and polyadenylation specificity factor (CPSF) complex that play a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition. CPSF4 binds RNA polymers with a preference for poly(U).
  • Sequence similarities
    Belongs to the CPSF4/YTH1 family.
    Contains 5 C3H1-type zinc fingers.
    Contains 1 CCHC-type zinc finger.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab161192 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161192 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Answer

The protein was purified under native conditions. Its elution buffer is 0.79% Tris-HCI, 0.31% reduced Glutathione, pH=8.0, and this is also the storage buffer

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up