Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MADGVDHIDIYADVGEEFNQEAEYGGHDQIDLYDDVISPSANNGDAPEDR DYMDTLPPTVGDDVGKGAAPNVVYTYTGKRIALYIGNLTWWTTDEDLTEA VHSLGVNDILEIKFFENRANGQSKGFALVGVGSEASSKKLMDLLPKRELH GQNPVVTPCNKQFLSQFEMQSRKTTQSGQMSGEGKAGPPLAGPPNRGDRP PPPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPPPPQQGPPPPPGPF PPRPPGPLGPPLTLAPPPHLPGPPPGAPPPAPHVNPAFFPPPTNSGMPTS DSRGPPPTDPYGRPPPYDRGDYGPPGREMDTARTPLSEAEFEEIMNRNRA ISSSAISRAVSDASAGDYGSAIETLVTAISLIKQSKVSADDRCKVLISSL QDCLHGIESKSYGSGSRRERSRERDHSRSREKSRRHKSRSRDRHDDYYRE RSRERERHRDRDRDRDRERDREREYRHR
    • Amino acids
      1 to 478
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161268 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CFIM
    • CFIm68
    • cleavage and polyadenylation specific factor 6, 68kDa
    • Cleavage and polyadenylation specificity factor 68 kDa subunit
    • Cleavage and polyadenylation specificity factor subunit 6
    • cleavage factor Im complex 68 kDa subunit
    • CPSF 68 kDa subunit
    • Cpsf6
    • CPSF6_HUMAN
    • HPBRII 4
    • HPBRII 7
    • Pre mRNA cleavage factor Im 68 kDa subunit
    • pre-mRNA cleavage factor I, 68kD subunit
    • pre-mRNA cleavage factor Im (68kD)
    • Pre-mRNA cleavage factor Im 68 kDa subunit
    • Protein HPBRII 4/7
    • Protein HPBRII-4/7
    see all
  • Function
    Component of the cleavage factor Im complex (CFIm) that plays a key role in pre-mRNA 3'-processing. Involved in association with NUDT21/CPSF5 in pre-MRNA 3'-end poly(A) site cleavage and poly(A) addition. CPSF6 binds to cleavage and polyadenylation RNA substrates and promotes RNA looping.
  • Sequence similarities
    Belongs to the RRM CPSF6/7 family.
    Contains 1 RRM (RNA recognition motif) domain.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus. In punctate subnuclear structures localized adjacent to nuclear speckles, called paraspeckles.
  • Information by UniProt

Images

  • ab161268 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161268 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161268.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up