Overview

  • Product name

    Recombinant Human CPVL protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      LFRSLYRSVSMPPKGDSGQPLFLTPYIEAGKIQKGRELSLVGPFPGLNMK SYAGFLTVNKTYNSNLFFWFFPAQIQPEDAPVVLWLQGGPGGSSMFGLFV EHGPYVVTSNMTLRDRDFPWTTTLSMLYIDNPVGTGFSFTDDTHGYAVNE DDVARDLYSALIQFFQIFPEYKNNDFYVTGESYAGKYVPAIAHLIHSLNP VREVKINLNGIAIGDGYSDPESIIGGYAEFLYQIGLLDEKQKKYFQKQCH ECIEHIRKQNWFEAFEILDKLLDGDLTSDPSYFQNVTGCSNYYNFLRCTE PEDQLYYVKFLSLPEVRQAIHVGNQTFNDGTIVEKYLREDTVQSVKPWLT EIMNNYKVLIYNGQLDIIVAAALTERSLMGMDWKGSQEYKKAEKKVWKIF KSDSEVAGYIRQVGDFHQVIIRGGGHILPYDQPLRAFDMINRFIYGKGWD PYVGVDHHHHHH
    • Molecular weight

      53 kDa including tags
    • Amino acids

      23 to 476
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is for the mature full length protein from aa 23 to 476. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab191931 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C or -80°C. Avoid freeze / thaw cycle. Reconstitute for long term storage.

    pH: 7.50
    Constituents: 10% Glycerol, 0.87% Sodium chloride, 0.32% Tris HCl

General Info

  • Alternative names

    • Carboxypeptidase
    • Carboxypeptidase vitellogenic like
    • carboxypeptidase WUG
    • CP-Mac carboxypeptidase
    • cpvl
    • CPVL_HUMAN
    • HVLP
    • MGC10029
    • Probable serine carboxypeptidase CPVL
    • Serine carboxypeptidase vitellogenic like
    • VCP like protein
    • VCP-like protein
    • Vitellogenic carboxypeptidase like protein
    • Vitellogenic carboxypeptidase-like protein
    • vitellogenic-like
    • VLP
    see all
  • Function

    May be involved in the digestion of phagocytosed particles in the lysosome, participation in an inflammatory protease cascade, and trimming of peptides for antigen presentation.
  • Tissue specificity

    Expressed in macrophages but not in other leukocytes. Abundantly expressed in heart and kidney. Also expressed in spleen, leukocytes, and placenta.
  • Sequence similarities

    Belongs to the peptidase S10 family.
  • Information by UniProt

References

ab191931 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191931.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up