Description

  • Product name

    Recombinant Human CRABP2 protein (His tag)
    See all CRABP2 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTF YIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLL KGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE
    • Predicted molecular weight

      17 kDa including tags
    • Amino acids

      2 to 138
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab219895 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C (stable for up to 12 months). Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 5% Trehalose, 95% PBS

    Lyophilized from 0.22 µm filtered solution.
    Note: 5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • Cellular retinoic acid binding protein 2
    • Cellular retinoic acid binding protein II
    • Cellular retinoic acid-binding protein 2
    • Cellular retinoic acid-binding protein II
    • CRABP II
    • CRABP-II
    • Crabp2
    • CRABPII
    • RABP2_HUMAN
    • RBP6
    • Rretinoic acid-binding protein, cellular, type II
    see all
  • Function

    Transports retinoic acid to the nucleus. Regulates the access of retinoic acid to the nuclear retinoic acid receptors.
  • Sequence similarities

    Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
  • Domain

    Forms a beta-barrel structure that accommodates hydrophobic ligands in its interior.
  • Cellular localization

    Cytoplasm. Nucleus. Upon ligand binding, a conformation change exposes a nuclear localization motif and the protein is transported into the nucleus.
  • Information by UniProt

Images

  • SDS-PAGE analysis of DTT-reduced ab219895 stained overnight with Coomassie Blue.

References

ab219895 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219895.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up