Overview

  • Product name

    Recombinant Human CRAT protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      KDKVNRDSVRSIQKSIFTVCLDATMPRVSEDVYRSHVAGQMLHGGGSRLN SGNRWFDKTLQFIVAEDGSCGLVYEHAAAEGPPIVTLLDYVIEYTKKPEL VRSPMVPLPMPKKLRFNITPEIKSDIEKAKQNLSIMIQDLDITVMVFHHF GKDFPKSEKLSPDAFIQMALQLAYYRIYGQACATYESASLRMFHLGRTDT IRSASMDSLTFVKAMDDSSVTEHQKVELLRKAVQAHRGYTDRAIRGEAFD RHLLGLKLQAIEDLVSMPDIFMDTSYAIAMHF
    • Molecular weight

      32 kDa
    • Amino acids

      268 to 549
    • Tags

      His-DHFR tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab127519 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 95 % Purified via His tag.
    >95% by SDS Page
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20ºC.

    Constituents: 0.32% Tris HCl, 0.58% Sodium chloride

  • Reconstitution
    Reconstitute with water to desired concentration

General Info

  • Alternative names

    • CACP_HUMAN
    • Carnitine acetylase
    • Carnitine acetyltransferase
    • Carnitine O acetyltransferase
    • Carnitine O-acetyltransferase
    • CAT
    • CAT1
    • CrAT
    see all
  • Function

    Carnitine acetylase is specific for short chain fatty acids. Carnitine acetylase seems to affect the flux through the pyruvate dehydrogenase complex. It may be involved as well in the transport of acetyl-CoA into mitochondria.
  • Tissue specificity

    Mostly in skeletal muscle, less in heart, liver and pancreas, only weakly detectable in brain, placenta, lung and kidney.
  • Sequence similarities

    Belongs to the carnitine/choline acetyltransferase family.
  • Cellular localization

    Mitochondrion; Peroxisome and Endoplasmic reticulum. Peroxisome. Mitochondrion inner membrane.
  • Information by UniProt

References

ab127519 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab127519.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up