Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      CGPMAAYVNPHGYVHETLTVYKACNLNLIGRPSTEHSWFPGYAWTVAQCK ICASHIGWKFTATKKDMSPQKFWGLTRSALLPTIPDTEDEISPDKVILCL
    • Amino acids
      343 to 442
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162450 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2610203G15Rik
    • 2900045O07Rik
    • AF229032
    • AW108261
    • Cereblon
    • Crbn
    • CRBN_HUMAN
    • DKFZp781K0715
    • MGC27358
    • MRT2A
    • OTTHUMP00000209555
    • piL
    • Protein cereblon
    • Protein x 0001
    see all
  • Function
    Component of some DCX (DDB1-CUL4-X-box) E3 protein ligase complex, a complex that mediates the ubiquitination and subsequent proteasomal degradation of target proteins and is required for limb outgrowth and expression of the fibroblast growth factor FGF8. In the complex, may act as a substrate receptor. Regulates the assembly and neuronal surface expression of large-conductance calcium-activated potassium channels in brain regions involved in memory and learning via its interaction with KCNT1.
  • Tissue specificity
    Widely expressed. Highly expressed in brain.
  • Pathway
    Protein modification; protein ubiquitination.
  • Involvement in disease
    Defects in CRBN are the cause of mental retardation autosomal recessive type 2A (MRT2A) [MIM:607417]. MRT2A patients display mild mental retardation with a standard IQ ranged from 50 to 70. IQ scores are lower in males than females. Developmental milestones are mildly delayed. There are no dysmorphic or autistic features. Non-syndromic mental retardation patients do not manifest other clinical signs.
  • Sequence similarities
    Belongs to the CRBN family.
    Contains 1 Lon domain.
  • Post-translational
    modifications
    Ubiquitinated, ubiquitination is mediated by its own DCX protein ligase complex.
  • Cellular localization
    Cytoplasm. Nucleus. Membrane.
  • Information by UniProt

Images

  • ab162450 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162450 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162450.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up