Description

  • Product name

    Recombinant Human Creatine kinase B type protein
    See all Creatine kinase B type proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    Purified by conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSG FTLDDVIQTG VDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHG GYKPSDEHKTDLNPDNLQGGDD LDPNYVLSSRVRTGRSIRGFCLPPHC SRGERRAIEKLAVEALSSLDGDLAGRYYALKSMT EAEQQQLIDDHFLF DKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISM QK GGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLR AGVHIKLP NLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNAD RLGFSEVELVQMVVDGVKLL IEMEQRLEQGQAIDDLMPAQK
    • Predicted molecular weight

      43 kDa
    • Amino acids

      1 to 381

Specifications

Our Abpromise guarantee covers the use of ab222357 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.0
    Constituents: 0.02% DTT, 10% Glycerol, 0.32% Tris HCl

General Info

  • Alternative names

    • B CK
    • B-CK
    • BB-CK
    • BCK
    • Brain creatine kinase
    • Ckb
    • CKBB
    • Creatine kinase B
    • Creatine kinase B chain
    • Creatine kinase B type
    • Creatine kinase B-type
    • Creatine Kinase BB Isoenzyme
    • Creatine kinase brain
    • Creatine kinase brain type
    • Creatine phosphokinase BB
    • Epididymis luminal protein 211
    • Epididymis secretory protein Li 29
    • HEL 211
    • HEL S 29
    • KCRB_HUMAN
    see all
  • Function

    Reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate). Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa.
  • Sequence similarities

    Belongs to the ATP:guanido phosphotransferase family.
    Contains 1 phosphagen kinase C-terminal domain.
    Contains 1 phosphagen kinase N-terminal domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • Recombinant human Creatine kinase B type (3μg) analysed by 15% SDS-PAGE.

References

ab222357 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222357.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up