Description

  • Product name

    Recombinant Human Creatine kinase B type protein (His tag)
    See all Creatine kinase B type proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      PFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGF TLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYK PSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGER RAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPL LLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFT RFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPN LGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQ MVVDGVKLLIEMEQRLEQGQAIDDLMPAQK
    • Predicted molecular weight

      44 kDa including tags
    • Amino acids

      2 to 381
    • Tags

      His tag N-Terminus
    • Additional sequence information

      The predicted N-terminus is Met (AAH19259).

Specifications

Our Abpromise guarantee covers the use of ab217816 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

    Lyophilised from 0.22 µm filtered solution.

  • Reconstitution
    Reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • B CK
    • B-CK
    • BB-CK
    • BCK
    • Brain creatine kinase
    • Ckb
    • CKBB
    • Creatine kinase B
    • Creatine kinase B chain
    • Creatine kinase B type
    • Creatine kinase B-type
    • Creatine Kinase BB Isoenzyme
    • Creatine kinase brain
    • Creatine kinase brain type
    • Creatine phosphokinase BB
    • Epididymis luminal protein 211
    • Epididymis secretory protein Li 29
    • HEL 211
    • HEL S 29
    • KCRB_HUMAN
    see all
  • Function

    Reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate). Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa.
  • Sequence similarities

    Belongs to the ATP:guanido phosphotransferase family.
    Contains 1 phosphagen kinase C-terminal domain.
    Contains 1 phosphagen kinase N-terminal domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • SDS-PAGE analysis of DTT-reduced ab217816 followed by staining overnight with Coomassie Blue.

    DTT-reduced protein migrates as 45 kDa in SDS-PAGE.

References

ab217816 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217816.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up