Overview

  • Product name

    Recombinant Human CREB3 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MELELDAGDQDLLAFLLEESGDLGTAPDEAVRAPLDWALPLSEVPSDWEV DDLLCSLLSPPASLNILSSSNPCLVHHDHTYSLPRETVSMDLESESCRKE GTQMTPQHMEELAEQEIARLVLTDEEKSLLEKEGLILPETLPLTKTEEQI LKRVRRKIRNKRSAQESRRKKKVYVGGLESRVLKYTAQNMELQNKVQLLE EQNLSLLDQLRKLQAMVIEISNKTSSSSTCILVLLVSFCLLLVPAIYSSD TRGSLPAEHGVLSRQLRALPSEDPYQLELPALQSEVPKDSTHQWLDGSDC VLQAPGNTSCLLHYMPQAPSAEPPLEWPFPDLFSEPLCRGPILPLQANLT RKGGWLPTGSPSVILQDRYSG
    • Amino acids

      1 to 371
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161017 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Basic leucine zipper protein
    • cAMP responsive element binding protein 3
    • Clic AMP responsive element binding protein 3
    • CREB 3
    • cyclic AMP response element (CRE) binding protein/activating transcription factor 1
    • Cyclic AMP responsive element binding protein 3
    • Leucine zipper protein
    • LUMAN
    • LZIP
    • MGC15333
    • MGC19782
    • Transcription factor LZIP alpha
    see all
  • Relevance

    This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds to the cAMP-responsive element, an octameric palindrome. The protein interacts with host cell factor C1, which also associates with the herpes simplex virus (HSV) protein VP16 that induces transcription of HSV immediate-early genes. This protein and VP16 both bind to the same site on host cell factor C1. It is thought that the interaction between this protein and host cell factor C1 plays a role in the establishment of latency during HSV infection. An additional transcript variant has been identified, but its biological validity has not been determined.
  • Cellular localization

    Isoform 2: Endoplasmic reticulum membrane; Single-pass type II membrane protein. Membrane. Isoform 3: Nucleus. Cytoplasm.

Images

  • ab161017 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161017 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161017.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up