Description

  • Product name

    Recombinant Human CREBBP protein (His tag)
    See all CREBBP proteins and peptides
  • Purity

    > 98 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      RKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVK NPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSK LAEVFEQEIDPVMQSLG
    • Predicted molecular weight

      15 kDa including tags
    • Amino acids

      1081 to 1197
    • Tags

      His tag N-Terminus
    • Additional sequence information

      GenBank Accession No. NM_004380

Specifications

Our Abpromise guarantee covers the use of ab198144 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.0
    Constituents: 0.71% Tris HCl, 0.72% Sodium chloride, 0.02% Potassium chloride, 10% Glycerol

General Info

  • Alternative names

    • CBP
    • CBP_HUMAN
    • CREB binding protein
    • CREB-binding protein
    • Crebbp
    • Cyclic AMP responsive enhancer binding protein
    • KAT3A
    • RSTS
    • RTS
    • Rubinstein Taybi syndrome
    see all
  • Function

    Acetylates histones, giving a specific tag for transcriptional activation. Also acetylates non-histone proteins, like NCOA3 coactivator. Binds specifically to phosphorylated CREB and enhances its transcriptional activity toward cAMP-responsive genes. Acts as a coactivator of ALX1 in the presence of EP300.
  • Involvement in disease

    Note=Chromosomal aberrations involving CREBBP may be a cause of acute myeloid leukemias. Translocation t(8;16)(p11;p13) with MYST3/MOZ; translocation t(11;16)(q23;p13.3) with MLL/HRX; translocation t(10;16)(q22;p13) with MYST4/MORF. MYST3-CREBBP may induce leukemia by inhibiting RUNX1-mediated transcription.
    Defects in CREBBP are a cause of Rubinstein-Taybi syndrome type 1 (RSTS1) [MIM:180849]. RSTS1 is an autosomal dominant disorder characterized by craniofacial abnormalities, broad thumbs, broad big toes, mental retardation and a propensity for development of malignancies.
  • Sequence similarities

    Contains 1 bromo domain.
    Contains 1 KIX domain.
    Contains 2 TAZ-type zinc fingers.
    Contains 1 ZZ-type zinc finger.
  • Domain

    The KIX domain mediates binding to HIV-1 Tat.
  • Post-translational
    modifications

    Methylation of the KIX domain by CARM1 blocks association with CREB. This results in the blockade of CREB signaling, and in activation of apoptotic response.
    Phosphorylated upon DNA damage, probably by ATM or ATR.
    Sumoylation negatively regulates transcriptional activity via the recruitment of DAAX.
  • Cellular localization

    Cytoplasm. Nucleus. Recruited to nuclear bodies by SS18L1/CREST. In the presence of ALX1 relocalizes from the cytoplasm to the nucleus.
  • Information by UniProt

Images

  • 4-20% SDS-PAGE Coomassie staining. Lane 1: 6 µg ab198144. Lane 2: Protein Marker

References

ab198144 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198144.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up