Recombinant Human CREBRF / LRF protein (ab165660)

Overview

  • Product name
    Recombinant Human CREBRF / LRF protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPQPSVSGMDPPFGDAFRSHTFSEQTLMSTDLLANSSDPDFMYELDREMN YQQNPRDNFLSLEDCKDIENLESFTDVLDNEGALTSNWEQWDTYCEDLTK YTKLTSCDIWGTKEVDYLGLDDFSSPYQDEEVISKTPTLAQLNSEDSQSV SDSLYYPDSLFSVKQNPLPSSFPGKKITSRAAAPVCSSKTLQAEVPLSDC VQKASKPTSSTQIMVKTNMYHNEKVNFHVECKDYVKKAKVKINPVQQSRP LLSQIHTDAAKENTCYCGAVAKRQEKKGMEPLQGHATPALPFKETQELLL SPLPQEGPGSLAAGESSSLSASTSVSDSSQKKEEHNYSLFVSDNLGEQPT KCSPEEDEEDEEDVDDEDHDEGFGSEHELSENEEEEEEEEDYEDDKDDDI SDTFSEPGYENDSVEDLKEVTSISSRKRGKRRYFWEYSEQLTPSQQERML RPSEWNRDTLPSNMYQKNGLHHGKYAVKKSRRADVEDLTPNPKKLLQIGN ELRKLNKVISDLTPVSELPLTARPRSRKEKNKLASRACRLKKKAQYEANK VKLWGLNTEYDNLLFVINSIKQEIVNRVQNPRDERGPNMGQKLEILIKDT LGLPVAGQTSEFVNQVLEKTAEGNPTGGLVGLRIPTSKV
    • Amino acids
      1 to 639
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165660 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • adult retina protein
    • C5orf41
    • Chromosome 5 Open Reading Frame 41
    • CREB3 regulatory factor
    • CREBRF
    • CRERF_HUMAN
    • Hypothetical protein
    • LRF
    • Luman recruitment factor
    see all
  • Function
    Acts as a negative regulator of the endoplasmic reticulum stress response or unfolded protein response (UPR). Represses the transcriptional activity of CREB3 during the UPR. Recruits CREB3 into nuclear foci.
  • Sequence similarities
    Belongs to the bZIP family. CREBRF subfamily.
    Contains 1 bZIP (basic-leucine zipper) domain.
  • Post-translational
    modifications
    Probably degraded by the proteasome.
  • Cellular localization
    Nucleus. Colocalizes with CREB3 in nuclear foci.
  • Information by UniProt

Images

  • ab165660 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165660 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165660.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up