Description

  • Product name

    Recombinant Human CRF1/CRHR1 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGGHPQLRLVKALLLLGLNPVSASLQDQHCESLSLASNISGLQCNASVDL IGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYS ECQEILNEEKKSKVHYHVAVIINYLGHCISLVALLVAFVLFLRLRSIRCL RNIIHWNLISAFILRNATWFVVQLTMSPEVHQSNVGWCRLVTAAYNYFHV TNFFWMFGEGCYLHTAIVLTYSTDRLRKWMFICIGWGVPFPIIVAWAIGK LYYDNEKCWFGKRPGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRA STTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDEVSRVVFIYFNSF LESFQGFFVSVFYCFLNSEVRSAIRKRWHRWQDKHSIRARVARAMSIPTS PTRVSFHSIKQSTAV
    • Predicted molecular weight

      74 kDa including tags
    • Amino acids

      1 to 415

Specifications

Our Abpromise guarantee covers the use of ab152297 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
    Best use within three months from the date of receipt of this protein.

     This product was previously labelled as CRF1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Corticotropin releasing factor type 1 receptor
    • corticotropin releasing hormone receptor 1
    • Corticotropin-releasing factor receptor 1
    • Corticotropin-releasing hormone receptor 1
    • CRF R
    • crf receptor 1
    • crf receptor type 1
    • crf type 1
    • CRF-R
    • CRF-R-1
    • CRF-R1
    • CRF1
    • CRFR
    • CRFR-1
    • CRFR1
    • CRFR1_HUMAN
    • CRH-R-1
    • CRH-R1
    • CRH-R1h
    • CRHR
    • Crhr1
    • CRHR1f
    • CRHR1L
    see all
  • Function

    This is a receptor for corticotropin releasing factor. Shows high-affinity CRF binding. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
  • Tissue specificity

    Predominantly expressed in the cerebellum, pituitary, cerebral cortex and olfactory lobe.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 2 family.
  • Post-translational
    modifications

    C-terminal Ser or Thr residues may be phosphorylated.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152297 stained with Coomassie Blue.

References

ab152297 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152297.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up