Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSPNFKLQCHFILIFLTALRGESRYLELREAADYDPFLLFSANLKRELAG EQPYRRALRCLDMLSLQGQFTFTADRPQLHCAAFFISEPEEFITIHYDQV SIDCQGGDFLKVFDGWILKGEKFPSSQDHPLPSAERYIDFCESGLSRRSI RSSQNVAMIFFRVHEPGNGFTLTIKTDPNLFPCNVISQTPNGKFTLVVPH QHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVELLGGT GLDPSKMTPLADLCYPFHGPAQMKVGCDNTVVRMVSSGKHVNRVTFEYRQ LEPYELENPNGNSIGEFCLSGL
    • Molecular weight
      61 kDa including tags
    • Amino acids
      1 to 322
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab156707 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl
    Note: Glutathione is reduced.

General Info

  • Alternative names
    • Corticotropin releasing factor binding protein
    • Corticotropin releasing hormone binding protein
    • CRF binding protein
    • CRF BP
    • CRFBP
    • CRH BP
    see all
  • Relevance
    CRHBP is a potent stimulator of synthesis and secretion of preopiomelanocortin derived peptides. Although CRH concentrations in the human peripheral circulation are normally low, they increase throughout pregnancy and fall rapidly after parturition. Maternal plasma CRH probably originates from the placenta. Human plasma contains a CRH binding protein which inactivates CRH and which may prevent inappropriate pituitary adrenal stimulation in pregnancy.
  • Cellular localization
    Extracellular space

References

ab156707 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab156707.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up