Overview

  • Product name

    Recombinant Human CRHR2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MDAALLHSLLEANCSLALAEELLLDGWGPPLDPEGPYSYCNTTLDQIGTC WPRSAAGALVERPCPEYFNGVKYNTTRNAYRECLENGTWASKINYSQCEP ILDDKQRKYDLHYRIALVVNYLGHCVSVAALVAAFLLFLALRSIRCLRNV IHWNLITTFILRNVMWFLLQLVDHEVHESNEVWCRCITTIFNYFVVTNFF WMFVEGCYLHTAIVMTYSTERLRKCLFLFIGWCIPFPIIVAWAIGKLYYE NEQCWFGKEPGDLVDYIYQGPIILVLLINFVFLFNIVRILMTKLRASTTS ETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDLSQIMFIYFNSFLQSF QGFFVSVFYCFFNGEVRSAVRKRWHRWQDHHSLRVPMARAMSIPTSPTRI SFHSIKQTAAV
    • Molecular weight

      74 kDa including tags
    • Amino acids

      1 to 411

Specifications

Our Abpromise guarantee covers the use of ab152298 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
    Best use within three months from the date of receipt of this protein.

     This product was previously labelled as Corticotropin Releasing Factor Receptor 2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Corticotropin releasing hormone receptor 2
    • Corticotropin-releasing factor receptor 2
    • Corticotropin-releasing hormone receptor 2
    • CRF 2
    • CRF 2R
    • CRF R2
    • CRF RB
    • CRF-R-2
    • CRF-R2
    • CRF2
    • CRF2 receptor beta isoform
    • CRF2R
    • CRFR 2
    • CRFR-2
    • CRFR2
    • CRFR2_HUMAN
    • CRH 2R
    • CRH R2
    • CRH-R-2
    • CRH-R2
    • CRH2R
    • CRHR 2
    • Crhr2
    • HM CRF
    see all
  • Function

    This is a receptor for corticotropin releasing factor. Shows high-affinity CRF binding. Also binds to urocortin I, II and III. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 2 family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152298 stained with Coomassie Blue.

References

ab152298 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152298.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up