Recombinant Human Cripto1/CRIPTO protein (Fc Chimera) (ab219888)

Description

  • Product name

    Recombinant Human Cripto1/CRIPTO protein (Fc Chimera)
    See all Cripto1/CRIPTO proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Lyophilized from 0.22 µm filtered solution .
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      LGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNR TCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSL CKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPELPPSART
    • Predicted molecular weight

      43 kDa including tags
    • Amino acids

      31 to 172
    • Additional sequence information

      Fused with a human IgG1 Fc tag at the C-terminus. This product is for the mature full length protein. The signal peptide is not included (NP_003203).

Specifications

Our Abpromise guarantee covers the use of ab219888 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

     This product was previously labelled as Cripto1

     

     This product was previously labelled as Cripto1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C (stable for up to 12 months). Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.61% Tris, 0.75% Glycine, L-Arginine, Sodium chloride, 5% Trehalose

  • Reconstitution
    Reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage. After reconstitution, store under sterile conditions for 3 months ( -70?).

General Info

  • Alternative names

    • CR
    • CRGF
    • cripto
    • Cripto 1
    • Cripto 1 growth factor
    • Cripto-1 growth factor
    • Cripto1 growth factor
    • Epidermal growth factor like cripto protein CR1
    • Epidermal growth factor-like cripto protein CR1
    • TDGF 1
    • TDGF1
    • TDGF1_HUMAN
    • Teratocarcinoma derived growth factor 1
    • Teratocarcinoma-derived growth factor 1
    see all
  • Function

    Could play a role in the determination of the epiblastic cells that subsequently give rise to the mesoderm.
  • Tissue specificity

    Preferentially expressed in gastric and colorectal carcinomas than in their normal counterparts.
  • Sequence similarities

    Contains 1 EGF-like domain.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab219888 stained overnight with Coomassie Blue.

    The protein migrates as 44-55 kDa under reducing conditions (SDS-PAGE) due to glycosylation.

     

References

ab219888 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219888.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up