Recombinant human Cripto1/CRIPTO protein (Tagged) (ab190395)
Key features and details
- Expression system: Escherichia coli
- Purity: > 90% SDS-PAGE
- Active: Yes
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant human Cripto1/CRIPTO protein (Tagged)
See all Cripto1/CRIPTO proteins and peptides -
Biological activity
Measured by its binding ability in a functional ELSA. Immobilized recombinant Human Nodal protein at 2µg/ml (100µl/well) can bind rhCripto-1 with a linear range of 0.5-100 ng/ml.
-
Purity
> 90 % SDS-PAGE.
ab190395 was refolded using a unique temperature shift inclusion body refolding technology and chromatographically purified. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MASMTGGQQMGRGHHHHHHGNLYFQGGEFLGHQEFARPSRGYLAFRDDSI WPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSF YGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCD -
Predicted molecular weight
17 kDa including tags -
Amino acids
31 to 150 -
Additional sequence information
Full length protein without signal peptide or propeptide. Constructed with a small T7-His-TEV cleavage site Tag (29 amino acids) fusion at the N-terminal.
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab190395 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Liquid -
Additional notes
This product was previously labelled as Cripto1
This product was previously labelled as Cripto1
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -80°C. Avoid freeze / thaw cycle.
pH: 8.00
Constituent: 0.32% Tris HCl
Contains NaCl, EDTA, KCl, arginine, DTT and glycerol.This product is an active protein and may elicit a biological response in vivo, handle with caution.
General Info
-
Alternative names
- CR
- CRGF
- cripto
see all -
Function
Could play a role in the determination of the epiblastic cells that subsequently give rise to the mesoderm. -
Tissue specificity
Preferentially expressed in gastric and colorectal carcinomas than in their normal counterparts. -
Sequence similarities
Contains 1 EGF-like domain. -
Cellular localization
Cell membrane. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab190395 has not yet been referenced specifically in any publications.