Description

  • Product name

    Recombinant Human CRISP2 protein
  • Purity

    > 90 % Densitometry.

  • Endotoxin level

    < 0.100 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MKHHHHHHASKDPAFTALLTTQLQVQREIVNKHNELRKAVSPPASNMLKM EWSREVTTNAQRWANKCTLQHSDPEDRKTSTRCGENLYMSSDPTSWSSAI QSWYDEILDFVYGVGPKSPNAVVGHYTQLVWYSTYQVGCGIAYCPNQDSL KYYYVCQYCPAGNNMNRKNTPYQQGTPCAGCPDDCDKGLCTNSCQYQDLL SNCDSLKNTAGCEHELLKEKCKATCLCENKIY
    • Predicted molecular weight

      27 kDa
    • Amino acids

      22 to 243
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab188468 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 4.00
    Constituents: 20% Glycerol, 0.08% DTT, 0.41% Sodium Acetate Buffer

General Info

  • Alternative names

    • Cancer/testis antigen 36
    • CRIS2_HUMAN
    • CRISP 2
    • CRISP-2
    • CRISP2
    • CT36
    • Cysteine rich secretory protein 2
    • Cysteine-rich secretory protein 2
    • GAPDL5
    • Glyceraldehyde 3 phosphate dehydrogenase like 5
    • Testis specific protein 1 (probe H4 1 p3 1)
    • Testis specific protein TPX1
    • Testis-specific protein TPX-1
    • TPX1
    • TSP1
    see all
  • Function

    May regulate some ion channels' activity and therebye regulate calcium fluxes during sperm capacitation.
  • Tissue specificity

    Testis and epididymis.
  • Sequence similarities

    Belongs to the CRISP family.
    Contains 1 SCP domain.
    Contains 1 ShKT domain.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 14% SDS-PAGE analysis of ab188468.

    Lane 1: Reduced and boiled sample, 2.5 μg

    Lane 2: Non-reduced and non-boiled sample, 2.5 μg

References

ab188468 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188468.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up