Description

  • Product name

    Recombinant Human Crk p38 protein
  • Purity

    > 95 % SDS-PAGE.
    ab101046 was purified by using conventional chromatography.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMAGNFDSEERSSWYWGRLSRQEAVALLQGQ RHGVFLVRDSSTSPGDYVLSVSENSRVSHYIINSSGPRPPVPPSPAQPPP GVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSRSRQGSGVILR QEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRG MIPVPYVEKYRPASASVSALIGGR
    • Predicted molecular weight

      25 kDa
    • Amino acids

      1 to 224
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101046 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.316% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • Adapter molecule crk
    • Avian sarcoma virus CT10 (v crk) oncogene homolog
    • CRK
    • CRK isoform 2
    • CRK isoform II
    • CRK_HUMAN
    • CRKII
    • FLJ38130
    • OTTHUMP00000115366
    • OTTHUMP00000198330
    • p38
    • Proto oncogene C crk
    • Proto-oncogene C-crk
    • v crk avian sarcoma virus CT10 oncogene homolog
    • v crk sarcoma virus CT10 oncogene homolog
    • v crk sarcoma virus CT10 oncogene homolog (avian)
    see all
  • Function

    The Crk-I and Crk-II forms differ in their biological activities. Crk-II has less transforming activity than Crk-I. Crk-II mediates attachment-induced MAPK8 activation, membrane ruffling and cell motility in a Rac-dependent manner. Involved in phagocytosis of apoptotic cells and cell motility via its interaction with DOCK1 and DOCK4.
  • Sequence similarities

    Belongs to the CRK family.
    Contains 1 SH2 domain.
    Contains 2 SH3 domains.
  • Domain

    The C-terminal SH3 domain function as a negative modulator for transformation and the N-terminal SH3 domain appears to function as a positive regulator for transformation.
    The SH2 domain mediates interaction with SHB.
  • Post-translational
    modifications

    Phosphorylation of Crk-II (40 kDa) gives rise to a 42 kDa form.
    Phosphorylated on Tyr-221 upon cell adhesion. Results in the negative regulation of the association with SH2- and SH3-binding partners, possibly by the formation of an intramolecular interaction of phosphorylated Tyr-221 with the SH2 domain. This leads finally to the down-regulation of the Crk signaling pathway.
  • Cellular localization

    Cytoplasm. Cell membrane. Translocated to the plasma membrane upon cell adhesion.
  • Information by UniProt

Images

  • ab101046, at 3 µg, analysed by 15 % SDS PAGE.

References

ab101046 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab101046.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up