Overview

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected insect cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      ADPQGGAAEGVQIQIIYFNLETVQVTWNASKYSRTNLTFHYRFNGDEAYD QCTNYLLQEGHTSGCLLDAEQRDDILYFSIRNGTHPVFTASRWMVYYLKP SSPKHVRFSWHQDAVTVTCSDLSYGDLLYEVQYRSPFDTEWQSKQENTCN VTIEGLDAEKCYSFWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACA ETPTPPKPKLSKHHHHHH
    • Molecular weight

      25 kDa including tags
    • Amino acids

      23 to 231
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain (NP_071431).

Specifications

Our Abpromise guarantee covers the use of ab224784 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    ab224784 was purified using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 10% Glycerol, PBS

General Info

  • Alternative names

    • CRL 2
    • CRL2
    • CRLF 2
    • Crlf2
    • CRLF2_HUMAN
    • CRLF2Y
    • Cytokine receptor CRL2 precusor
    • Cytokine receptor like 2
    • Cytokine receptor like factor 2
    • Cytokine receptor like factor 2 precursor
    • Cytokine receptor-like 2
    • Cytokine receptor-like factor 2
    • IL XR
    • IL-XR
    • ILXR
    • Thymic stromal derived lymphopoietin receptor
    • Thymic stromal lymphopoietin protein receptor
    • Thymic stromal lymphopoietin receptor
    • TSLP receptor
    • TSLPR
    see all
  • Function

    Receptor for thymic stromal lymphopoietin (TSLP). Forms a functional complex with TSLP and IL7R which is capable of stimulating cell proliferation through activation of STAT3 and STAT5. Also activates JAK2 (By similarity). Implicated in the development of the hematopoietic system.
  • Tissue specificity

    Expressed in heart, skeletal muscle, kidney and adult and fetal liver. Primarily expressed in dendrites and monocytes. Weakly expressed in T-cells.
  • Sequence similarities

    Belongs to the type I cytokine receptor family. Type 5 subfamily.
    Contains 1 fibronectin type-III domain.
  • Domain

    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is important for association with JAKs.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab224784.

    MW: 28-40 kDa (SDS-PAGE under reducing conditions).

References

ab224784 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224784.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up