Description

  • Product name

    Recombinant Human CRMP1 protein
    See all CRMP1 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab202599 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSEFMSYQGKKSIPHITSDRLLIKGGRII NDDQSLYADVYLEDGLIKQIGENLIVPGGVKTIEANGRMVIPGGIDVNTY LQKPSQGMTAADDFFQGTRAALVGGTTMIIDHVVPEPGSSLLTSFEKWHE AADTKSCCDYSLHVDITSWYDGVREELEVLVQDKGVNSFQVYMAYKDVYQ MSDSQLYEAFTFLKGLGAVILVHAENGDLIAQEQKRILEMGITGPEGHAL SRPEELEAEAVFRAITIAGRINCPVYITKVMSKSAADIIALARKKGPLVF GEPIAASLGTDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYLTSLLACGD LQVTGSGHCPYSTAQKAVGKDNFTLIPEGVNGIEERMTVVWDKAVATGKM DENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKLKTITAKSH KSAVEYNIFEGMECHGSPLVVISQGKIVFEDGNINVNKGMGRFIPRKAFP EHLYQRVKIRNKVFGLQGVSRGMYDGPVYEVPATPKYATPAPSAKSSPSK HQPPPIRNLHQSNFSLSGAQIDDNNPRRTGHRIVAPPGGRSNITSLG
    • Predicted molecular weight

      65 kDa including tags
    • Amino acids

      1 to 572
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_001304.

Specifications

Our Abpromise guarantee covers the use of ab202599 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 10% Glycerol, 0.00348% PMSF, 0.02% DTT, 89% PBS

General Info

  • Alternative names

    • Collapsin response mediator protein 1
    • CRMP 1
    • CRMP-1
    • Crmp1
    • Dihydropyrimidinase like 1
    • Dihydropyrimidinase related protein 1
    • Dihydropyrimidinase-related protein 1
    • DPYL1_HUMAN
    • DPYSL1
    • DRP 1
    • DRP-1
    • DRP1
    • ULIP-3
    • Ulip3
    • Unc-33-like phosphoprotein 3
    see all
  • Function

    Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. Plays a role in axon guidance, invasive growth and cell migration.
  • Tissue specificity

    Brain.
  • Sequence similarities

    Belongs to the DHOase family. Hydantoinase/dihydropyrimidinase subfamily.
  • Cellular localization

    Cytoplasm. Cytoplasm > cytoskeleton > centrosome. Cytoplasm > cytoskeleton > spindle. Associated with centrosomes and the mitotic spindle during metaphase.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab202599.

References

ab202599 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202599.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up