Description

  • Product name

    Recombinant Human CROP protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTN TRSDLDVFGRGDNISDVSKFLEDDKWMEE
    • Predicted molecular weight

      36 kDa including tags
    • Amino acids

      1 to 79

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132869 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • cAMP regulatory element-associated protein 1
    • Cisplatin resistance-associated overexpressed protein
    • Cisplatin resistance-associated-overexpressed protein
    • CRA
    • CRE-associated protein 1
    • CREAP-1
    • CREAP1
    • CROP
    • hLuc7A
    • LC7L3_HUMAN
    • LUC7 like 3 pre mRNA splicing factor
    • Luc7-like protein 3
    • Luc7A
    • LUC7L3
    • O48
    • OA48 18
    • Okadaic acid-inducible phosphoprotein OA48-18
    see all
  • Function

    Binds cAMP regulatory element DNA sequence. May play a role in RNA splicing.
  • Tissue specificity

    Widely expressed. Highest levels in heart, brain, pancreas, thymus, ovary, small intestine and peripheral blood leukocytes, as well as cerebellum, putamen and pituitary gland. Lowest levels in lung, liver and kidney. Also expressed in fetal tissues, including brain, heart, kidney, thymus and lung.
  • Sequence similarities

    Belongs to the Luc7 family.
  • Post-translational
    modifications

    Phosphorylated in vitro by SRPK1, SRPK2 and CLK1.
  • Cellular localization

    Nucleus speckle. The subnuclear localization is affected by cisplatin.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132869 stained with Coomassie Blue.

References

ab132869 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132869.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up