Recombinant Human CRYBA4 protein (ab113143)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Tags: His tag N-Terminus
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Human CRYBA4 protein -
Purity
> 95 % SDS-PAGE.
ab113143 was purified using conventional chromatography. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MGSSHHHHHHSSGLVPRGSHMTLQCTKSAGPWKMVVWDEDGFQGRRHEFT AECPSVLELGFETVRSLKVLSGAWVGFEHAGFQGQQYILERGEYPSWDAW GGNTAYPAERLTSFRPAACANHRDSRLTIFEQENFLGKKGELSDDYPSLQ AMGWEGNEVGSFHVHSGAWVCSQFPGYRGFQYVLECDHHSGDYKHFREWG SHAPTFQVQSIRRIQQ -
Predicted molecular weight
25 kDa including tags -
Amino acids
1 to 196 -
Tags
His tag N-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab113143 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Mass spectrometry
MALDI-TOF -
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 8.00
Constituents: 0.02% DTT, 0.32% Tris HCl, 20% Glycerol (glycerin, glycerine), 0.58% Sodium chloride
General Info
-
Alternative names
- Beta A4 crystallin
- Beta crystallin A4
- Beta-A4 crystallin
see all -
Function
Crystallins are the dominant structural components of the vertebrate eye lens. -
Involvement in disease
Defects in CRYBA4 are the cause of cataract zonular type 2 (CZ2) [MIM:610425]; also known as lamellar cataract 2. A form of zonular cataract. Zonular or lamellar cataracts are opacities, broad or narrow, usually consisting of powdery white dots affecting only certain layers or zones between the cortex and nucleus of an otherwise clear lens. The opacity may be so dense as to render the entire central region of the lens completely opaque, or so translucent that vision is hardly if at all impeded. Zonular cataracts generally do not involve the embryonic nucleus, though sometimes they involve the fetal nucleus. Usually sharply separated from a clear cortex outside them, they may have projections from their outer edges known as riders or spokes.
Defects in CRYBA4 are a cause of microphthalmia isolated with cataract type 4 (MCOPCT4) [MIM:610426]. Microphthalmia is a clinically heterogeneous disorder of eye formation, ranging from small size of a single eye to complete bilateral absence of ocular tissues. Ocular abnormalities like opacities of the cornea and lens, scaring of the retina and choroid, cataractand other abnormalities like cataract may also be present. -
Sequence similarities
Belongs to the beta/gamma-crystallin family.
Contains 4 beta/gamma crystallin 'Greek key' domains. -
Domain
Has a two-domain beta-structure, folded into four very similar Greek key motifs. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab113143 has not yet been referenced specifically in any publications.