Overview

  • Product name
    Recombinant Human CRYGB protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      IRSCCLIPPHSGAYRMKIYDRDELRGQMSELTDDCLSVQDRFHLTEIHSL NVLEGSWILYEMPNYRGRQYLLRPGEYRRFLDWGAPNAKVGSLRRVMDLY
    • Amino acids
      76 to 175
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158207 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CRGB_HUMAN
    • Crygb
    • Gamma-B-crystallin
    • Gamma-crystallin 1-2
    • Gamma-crystallin B
    see all
  • Function
    Crystallins are the dominant structural components of the vertebrate eye lens.
  • Sequence similarities
    Belongs to the beta/gamma-crystallin family.
    Contains 4 beta/gamma crystallin 'Greek key' domains.
  • Domain
    Has a two-domain beta-structure, folded into four very similar Greek key motifs.
  • Information by UniProt

Images

  • ab158207 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158207 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158207.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up