Description

  • Product name

    Recombinant Human CSGALNACT1 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MMMVRRGLLAWISRVVVLLVLLCCAISVLYMLACTPKGDEEQLALPRANS PTGKEGYQAVLQEWEEQHRNYVSSLKRQIAQLKEELQERSEQLRNGQYQA SDAAGLGLDRSPPEKTQADLLAFLHSQVDKAEVNAGVKLATEYAAVPFDS FTLQKVYQLETGLTRHPEEKPVRKDKRDELVEAIESALETLNNPAENSPN HRPYTASDFIEGIYRTERDKGTLYELTFKGDHKHEFKRLILFRPFGPIMK VENEKLNMANTLINVIVPLAKRVDKFRQFMQNFRPADEVFRCVPLSP
    • Amino acids

      1 to 297
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163222 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 4-N-acetylgalactosaminyltransferase 1
    • beta4GalNAcT
    • Beta4GalNAcT 1
    • Beta4GalNAcT-1
    • Beta4GalNAcT1
    • CGAT1_HUMAN
    • ChGn
    • Chondroitin beta-1
    • Chondroitin beta1 4 N acetylgalactosaminyltransferase
    • Chondroitin beta1 4 N acetylgalactosaminyltransferase 1
    • Chondroitin sulfate N acetylgalactosaminyltransferase 1
    • Chondroitin sulfate N-acetylgalactosaminyltransferase 1
    • CSGalNAcT 1
    • CsGalNAcT-1
    • Csgalnact1
    • FLJ11264
    • FLJ13760
    see all
  • Function

    Transfers 1,4-N-acetylgalactosamine (GalNAc) from UDP-GalNAc to the non-reducing end of glucuronic acid (GlcUA). Required for addition of the first GalNAc to the core tetrasaccharide linker and for elongation of chondroitin chains. Important role in chondroitin chain biosynthesis in cartilage.
  • Tissue specificity

    Ubiquitous, with the highest levels in placenta, thyroid, bladder, prostate and adrenal gland. Detected at low levels in the other tissues examined.
  • Sequence similarities

    Belongs to the chondroitin N-acetylgalactosaminyltransferase family.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Golgi apparatus > Golgi stack membrane.
  • Information by UniProt

Images

  • ab163222 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163222 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163222.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up