Description

  • Product name

    Recombinant Human CSL4 protein
  • Purity

    > 90 % SDS-PAGE.
    ab181892 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMAPPVRYCIPGERLCNLEEGSPGSGTY TRHGYIFSSLAGCLMKSSENGALPVVSVVRETESQLLPDVGAIVTCKVSS INSRFAKVHILYVGSMPLKNSFRGTIRKEDVRATEKDKVEIYKSFRPGDI VLAKVISLGDAQSNYLLTTAENELGVVVAHSESGIQMVPISWCEMQCPKT HTKEFRKVARVQPEFLQT
    • Predicted molecular weight

      24 kDa including tags
    • Amino acids

      1 to 195
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_057130

Specifications

Our Abpromise guarantee covers the use of ab181892 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.88% Sodium chloride, 20% Glycerol, 0.02% DTT

General Info

  • Alternative names

    • 3'-5' exoribonuclease CSL4 homolog
    • CGI 108
    • CGI-108
    • CSL4
    • CSL4 exosomal core protein homolog
    • CSL4, S. cerevisiae, homolog of
    • Csl4p
    • EXOS1_HUMAN
    • Exosc1
    • Exosomal core protein CSL4
    • Exosome complex component csl4
    • Exosome component 1
    • hCsl4p
    • Homolog of yeast exosomal core protein CSL4
    • p13
    • RP11-452K12.9
    • SKI4
    • Ski4p
    see all
  • Function

    Non-catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity and participates in a multitude of cellular RNA processing and degradation events. In the nucleus, the RNA exosome complex is involved in proper maturation of stable RNA species such as rRNA, snRNA and snoRNA, in the elimination of RNA processing by-products and non-coding 'pervasive' transcripts, such as antisense RNA species and promoter-upstream transcripts (PROMPTs), and of mRNAs with processing defects, thereby limiting or excluding their export to the cytoplasm. The RNA exosome may be involved in Ig class switch recombination (CSR) and/or Ig variable region somatic hypermutation (SHM) by targeting AICDA deamination activity to transcribed dsDNA substrates. In the cytoplasm, the RNA exosome complex is involved in general mRNA turnover and specifically degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3' untranslated regions, and in RNA surveillance pathways, preventing translation of aberrant mRNAs. It seems to be involved in degradation of histone mRNA. The catalytic inactive RNA exosome core complex of 9 subunits (Exo-9) is proposed to play a pivotal role in the binding and presentation of RNA for ribonucleolysis, and to serve as a scaffold for the association with catalytic subunits and accessory proteins or complexes. EXOSC1 as peripheral part of the Exo-9 complex stabilizes the hexameric ring of RNase PH-domain subunits through contacts with EXOSC6 and EXOSC8.
  • Sequence similarities

    Contains 1 S1 motif domain.
  • Cellular localization

    Nucleus > nucleolus. Nucleus. Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab181892.

References

ab181892 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab181892.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up