Description

  • Product name

    Recombinant Human CSN7A protein
    See all CSN7A proteins and peptides
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSAEVKVTGQNQEQFLLLAKSAKGAALATLIHQVLEAPGVYVFGELLDMP NVRELAESDFASTFRLLTVFAYGTYADYLAEARNLPPLTEAQKNKLRHLS VVTLAAKVKCIPYAVLLEALALRNVRQLEDLVIEAVYADVLRGSLDQRNQ RLEVDYSIGRDIQRQDLSAIARTLQEWCVGCEVVLSGIEEQVSRANQHKE QQLGLKQQIESEVANLKKTIKVTTAAAAAATSQDPEQHLTELREPAPGTN QRQPSKKASKGKGLRGSAKIWSKSN
    • Amino acids

      1 to 275
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162359 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as COPS7A

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • COP9 complex subunit 7a
    • COP9 constitutive photomorphogenic homolog subunit 7A
    • COP9 signalosome complex subunit 7a
    • COP9 signalosome subunit 7A
    • COPS7A
    • CSN7A
    • CSN7A_HUMAN
    • Dermal papilla derived protein 10
    • Dermal papilla-derived protein 10
    • DERP10
    • JAB1 containing signalosome subunit 7a
    • JAB1-containing signalosome subunit 7a
    • SGN7a
    • Signalosome subunit 7a
    see all
  • Function

    Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, JUN, I-kappa-B-alpha/NFKBIA, ITPK1 and IRF8/ICSBP, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively.
  • Tissue specificity

    Widely expressed. Expressed at high level in brain, heart and skeletal muscle.
  • Sequence similarities

    Belongs to the CSN7/EIF3M family. CSN7 subfamily.
    Contains 1 PCI domain.
  • Post-translational
    modifications

    Phosphorylated by CK2 and PKD kinases.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • ab162359 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162359 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162359.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up