Overview

  • Product name
    Recombinant Human CSN7b protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAGEQKPSSNLLEQFILLAKGTSGSALTALISQVLEAPGVYVFGELLELA NVQELAEGANAAYLQLLNLFAYGTYPDYIANKESLPELSTAQQNKLKHLT IVSLASRMKCIPYSVLLKDLEMRNLRELEDLIIEAVYTDIIQGKLDQRNQ LLEVDFCIGRDIRKKDINNIVKTLHEWCDGCEAVLLGIEQQVLRANQYKE NHNRTQQQVEAEVTNIKKTLKATASSSAQEMEQQLAERECPPHAEQRQPT KKMSKVKGLVSSRH
    • Amino acids
      1 to 264
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163857 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • COP9 Complex Homolog Subunit 7b
    • COP9 Constitutive Photomorphogenic Homolog Subunit 7b
    • COP9 Signalasome Subunit 7b
    • COP9 signalosome complex subunit 7b
    • COPS7B
    • CSN7B_HUMAN
    • JAB1 Containing Signalosome Subunit 7b
    • JAB1-containing signalosome subunit 7b
    • SGN7b
    • Signalosome subunit 7b
    see all
  • Function
    Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, JUN, I-kappa-B-alpha/NFKBIA, ITPK1 and IRF8/ICSBP, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively.
  • Sequence similarities
    Belongs to the CSN7/EIF3M family. CSN7 subfamily.
    Contains 1 PCI domain.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • ab163857 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163857 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163857.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up