Recombinant human CSNK1A1L protein (ab191034)

Description

  • Product name

    Recombinant human CSNK1A1L protein
  • Biological activity

    The specific activity of ab191034 was determined to be 160 nmol/min/mg.

  • Purity

    > 75 % Densitometry.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MTNNSGSKAELVVGGKYKLVRKIGSGSFGDVYLGITTTNGEEVAVKLESQ KVKHPQLLYESKLYTILQGGVGIPHMHWYGQEKDNNVLVMDLLGPSLEDL FNFCSRRFTMKTVLMLADQMISRIEYVHTKNFLHRDIKPDNFLMGTGRHC NKLFLIDFGLAKKYRDNRTRQHIPYREDKHLIGTVRYASINAHLGIEQSR RDDMESLGYVFMYFNRTSLPWQGLKAMTKKQKYEKISEKKMSTPVEVLCK GFPAEFAMYLNYCRGLRFEEVPDYMYLRQLFRILFRTLNHQYDYTFDWTM LKQKAAQQAASSSGQGQQAQTQTGKQTEKNKNNVKDN
    • Predicted molecular weight

      64 kDa including tags
    • Amino acids

      1 to 337
    • Tags

      proprietary tag N-Terminus
    • Additional sequence information

      BC028723.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab191034 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    ab91092 (Cow Casein full length protein) can be utilized as a substrate for assessing Kinase activity

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 0.79% Tris HCl, 0.31% Glutathione, 0.87% Sodium chloride, 0.003% EDTA, 0.004% DTT, 25% Glycerol, 0.002% PMSF

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Casein kinase 1, alpha 1 like
    • casein kinase 1, alpha 1-like
    • Casein kinase I alpha S like
    • Casein kinase I isoform alpha like
    • CK1
    • CKI alpha like
    • MGC33182
    • OTTHUMP00000018267
    • RP11 532O21.2
    see all
  • Relevance

    Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. CSNK1A1L can phosphorylate a large number of proteins and participates in Wnt signaling.
  • Cellular localization

    Cytoplasmic

Images

  • The specific activity of CSNK1A1L (ab191034) was determined to be 160 nmol/min/mg as per activity assay protocol
  • SDS PAGE analysis of ab191034
  • SDS PAGE analysis of ab191034
  • Kinase assay showing the specific activity of ab191034 to be 160 nmol/min/mg.

  • SDS-PAGE analysis of ab191034.

References

ab191034 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191034.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up