Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      WGYVSMSTLATTLQEVLLTVQKDCQCERLFHGNYSRATEICVGDPKKTQT GFKGDSGGPLVCKDVAQGILSYGNKKGTPPGVYIKVSHFLPWIKRTMKRL
    • Amino acids

      147 to 246
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158618 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as Granzyme H.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Cathepsin G like 2
    • Cathepsin G-like 2
    • CCP X
    • CCP-X
    • CGL 2
    • CGL2
    • CSP C
    • CSP-C
    • CTLA1
    • CTSGL2
    • Cytotoxic serine protease C
    • Cytotoxic T lymphocyte associated serine esterase 1
    • Cytotoxic T lymphocyte proteinase
    • Cytotoxic T-lymphocyte proteinase
    • EC 3.4.21.-
    • GRAH_HUMAN
    • Granzyme H
    • Granzyme H (cathepsin G-like 2, protein h-CCPX)
    • GZMH
    • Protein h CCPX
    see all
  • Function

    Cytotoxic chymotrypsin-like serine protease with preference for bulky and aromatic residues at the P1 position and acidic residues at the P3' and P4' sites. Probably necessary for target cell lysis in cell-mediated immune responses. Participates in the antiviral response via direct cleavage of several proteins essential for viral replication.
  • Tissue specificity

    Constituvely expressed in NK cells.
  • Sequence similarities

    Belongs to the peptidase S1 family. Granzyme subfamily.
    Contains 1 peptidase S1 domain.
  • Cellular localization

    Cytoplasmic granule. Cytoplasmic granules of cytolytic T-lymphocytes.
  • Information by UniProt

Images

  • ab158618 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158618 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158618.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up