Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      EVLLTVQKDCQCERLFHGNYSRATEICVGDPKKTQTGFKGDSGGPLVCKD VAQGILSYGNKKGTPPGVYIKVSHFLPWIKRTMKRL
    • Amino acids
      161 to 246
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158619 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as Granzyme H.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cathepsin G like 2
    • Cathepsin G-like 2
    • CCP X
    • CCP-X
    • CGL 2
    • CGL2
    • CSP C
    • CSP-C
    • CTLA1
    • CTSGL2
    • Cytotoxic serine protease C
    • Cytotoxic T lymphocyte associated serine esterase 1
    • Cytotoxic T lymphocyte proteinase
    • Cytotoxic T-lymphocyte proteinase
    • EC 3.4.21.-
    • GRAH_HUMAN
    • Granzyme H
    • Granzyme H (cathepsin G-like 2, protein h-CCPX)
    • GZMH
    • Protein h CCPX
    see all
  • Function
    Cytotoxic chymotrypsin-like serine protease with preference for bulky and aromatic residues at the P1 position and acidic residues at the P3' and P4' sites. Probably necessary for target cell lysis in cell-mediated immune responses. Participates in the antiviral response via direct cleavage of several proteins essential for viral replication.
  • Tissue specificity
    Constituvely expressed in NK cells.
  • Sequence similarities
    Belongs to the peptidase S1 family. Granzyme subfamily.
    Contains 1 peptidase S1 domain.
  • Cellular localization
    Cytoplasmic granule. Cytoplasmic granules of cytolytic T-lymphocytes.
  • Information by UniProt

Images

  • ab158619 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158619 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158619.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up