Description

  • Product name

    Recombinant Human CSRP1 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVCKKNLDSTTVA VHGEEIYCKSCYGKKYGPKGYGYGQGAGTLSTDKGESLGIKHEEAPGHRP TTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKSWHKACFRCAKCG KGLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQGAGALVHSE
    • Predicted molecular weight

      47 kDa including tags
    • Amino acids

      1 to 193

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114649 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CRP
    • CRP 1
    • CRP1
    • CSRP
    • CSRP 1
    • CSRP1
    • CSRP1_HUMAN
    • CYRP
    • Cysteine and glycine rich protein 1
    • Cysteine and glycine-rich protein 1
    • Cysteine rich protein
    • Cysteine rich protein 1
    • Cysteine-rich protein 1
    • D1S181E
    • DKFZp686M148
    • Epididymis luminal protein 141
    • Epididymis secretory protein Li 286
    • HEL 141
    • HEL S 286
    • LIM domain protein
    see all
  • Function

    Could play a role in neuronal development.
  • Sequence similarities

    Contains 2 LIM zinc-binding domains.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab114649 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114649 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114649.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up